Research Article

[Retracted] Exploration of ACE-Inhibiting Peptides Encrypted in Artemisia annua Using In Silico Approach

Table 4

In the best docking pose of the ligand-receptor complex, hydrogen bonds and their distances (Å) with ACE residues are shown.

ACE residues in H-bondingNumber of H-bonds and their corresponding distance (Å)Captopril
FGFPAFFRFYGWLWRFRWWGMWWLYFCFGFMF

THR144:OG11 (2.7)1 (2.1)1 (2.6)1 (3.7)1 (1.9)1 (2.0)1 (2.0)
TYR2:O2 (2.1, 2.3)
ASN70:OD11 (3.3)1 (1.9)1 (2.6)1 (1.9)1 (2.8)
LEU140:O1 (3.0)2 (2.9, 2.5)1 (2.7)1 (2.6)1 (3.0)1 (3.7)
ILE73:O1 (2.6)1 (2.3)1 (2.5)
SER516:O2 (2.7, 2.9)1 (2.3)1 (2.2)1 (2.0)1 (3.3)
PHE1:O1 (2.1)1 (3.0)1 (3.6)1 (2.2)1 (3.3)1 (2.9)
TRP2:O1 (3.8)2 (3.4)
ARG1:O1 (2.8)
PRO515:O1 (2.4)
GLU143:OE11 (2.5)1 (2.1)1 (2.7)1 (3.6)
LEU1:O1 (2.4)1 (3.6)
THR75:O1 (2.6)2 (2.4, 2.0)1 (2.0)
TYR523:OH1 (2.0)1 (2.6)1 (2.6)
ASN66:OD11 (3.2)1 (2.5)1 (3.0)1 (2.2)
SER78:OG2 (2.3, 2.4)1 (2.5)1 (2.5)2 (3.6, 2.8)
TRP2:OXT1 (3.8)1 (3.0)1 (3.0)1 (2.3)1 (3.8)
HIS513:NE21 (2.4)2 (2.5, 3.0)1 (2.1)
ASP141:OD11 (2.5)1 (2.3)
Total64564345533634455