Research Article
ITIH4: A New Potential Biomarker of “Toxin Syndrome” in Coronary Heart Disease Patient Identified with Proteomic Method
Table 5
Peptides identification unique to “Toxin”.
| | Mass | IPI | Gene_Symbol | Amino acid sequence |
| | 4280.13 Da | IPI00218192.3 | ITIH4 Isoform 2 of inter-alpha-trypsin inhibitor heavy chain H4 | R.NVHSAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPF.R |
| | 3206.42 Da | IPI00021885.1 | FGA Isoform 1 of Fibrinogen alpha chain precursor | K.SSSYSKQFTSSTSYNRGDSTFESKSYKM*.A |
|
|